Lineage for d1df0b_ (1df0 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319424Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2319425Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2320686Family a.39.1.8: Penta-EF-hand proteins [63550] (7 protein domains)
  6. 2320700Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)
  7. 2320717Species Norway rat (Rattus norvegicus) [TaxId:10116] [47554] (8 PDB entries)
  8. 2320725Domain d1df0b_: 1df0 B: [17369]
    Other proteins in same PDB: d1df0a1, d1df0a2, d1df0a3

Details for d1df0b_

PDB Entry: 1df0 (more details), 2.6 Å

PDB Description: crystal structure of m-calpain
PDB Compounds: (B:) calpain

SCOPe Domain Sequences for d1df0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1df0b_ a.39.1.8 (B:) Calpain small (regulatory) subunit (domain VI) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
neseeerqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmd
sdttgklgfeefkylwnnikkwqgiykrfdtdrsgtigsnelpgafeaagfhlnqhiysm
iirrysdetgnmdfdnfisclvrldamfrafrsldkngtgqiqvniqewlqltmys

SCOPe Domain Coordinates for d1df0b_:

Click to download the PDB-style file with coordinates for d1df0b_.
(The format of our PDB-style files is described here.)

Timeline for d1df0b_: