Lineage for d1aj5b_ (1aj5 B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 97344Fold a.39: EF Hand-like [47472] (4 superfamilies)
  4. 97345Superfamily a.39.1: EF-hand [47473] (8 families) (S)
  5. 97667Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (8 proteins)
  6. 97680Protein Calpain small (regulatory) subunit (domain VI) [47552] (3 species)
  7. 97689Species Rat (Rattus norvegicus) [TaxId:10116] [47554] (3 PDB entries)
  8. 97693Domain d1aj5b_: 1aj5 B: [17368]

Details for d1aj5b_

PDB Entry: 1aj5 (more details), 2.3 Å

PDB Description: calpain domain vi apo

SCOP Domain Sequences for d1aj5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aj5b_ a.39.1.7 (B:) Calpain small (regulatory) subunit (domain VI) {Rat (Rattus norvegicus)}
eeerqfrklfvqlagddmevsatelmnilnkvvtrhpdlktdgfgidtcrsmvavmdsdt
tgklgfeefkylwnnikkwqgiykrfdtdrsgtigsnelpgafeaagfhlnqhiysmiir
rysdetgnmdfdnfisclvrldamfrafrsldkngtgqiqvniqewlqltmys

SCOP Domain Coordinates for d1aj5b_:

Click to download the PDB-style file with coordinates for d1aj5b_.
(The format of our PDB-style files is described here.)

Timeline for d1aj5b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1aj5a_