Lineage for d3d4kb_ (3d4k B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943754Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 943755Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 943756Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 943760Protein Concanavalin A [49901] (3 species)
    natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop
  7. 943770Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (51 PDB entries)
    Uniprot P81461
  8. 943782Domain d3d4kb_: 3d4k B: [173678]
    automated match to d1apna_
    complexed with ca, gol, h1m, man, mn

Details for d3d4kb_

PDB Entry: 3d4k (more details), 1.8 Å

PDB Description: concanavalin a complexed to a synthetic analog of the trimannoside
PDB Compounds: (B:) Concanavalin-A

SCOPe Domain Sequences for d3d4kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d4kb_ b.29.1.1 (B:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d3d4kb_:

Click to download the PDB-style file with coordinates for d3d4kb_.
(The format of our PDB-style files is described here.)

Timeline for d3d4kb_: