Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.1: Microbial ribonucleases [53932] (1 superfamily) single helix packs against antiparallel beta-sheet |
Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) |
Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins) |
Protein automated matches [190834] (2 species) not a true protein |
Species Streptomyces aureofaciens [TaxId:1894] [188142] (10 PDB entries) |
Domain d3d4ac_: 3d4a C: [173674] automated match to d1py3b_ complexed with 3gp, so4 |
PDB Entry: 3d4a (more details), 2.2 Å
SCOPe Domain Sequences for d3d4ac_:
Sequence, based on SEQRES records: (download)
>d3d4ac_ d.1.1.2 (C:) automated matches {Streptomyces aureofaciens [TaxId: 1894]} ladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvtpgs ndrgtrrvvtggygeqywspdhyatfqeidprc
>d3d4ac_ d.1.1.2 (C:) automated matches {Streptomyces aureofaciens [TaxId: 1894]} ladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvtprg trrvvtggygeqywspdhyatfqeidprc
Timeline for d3d4ac_: