SCOPe 2.08: Domain d3d4ac_: 3d4a C:

Lineage for d3d4ac_ (3d4a C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
   single helix packs against antiparallel beta-sheet

4. Superfamily d.1.1: Microbial ribonucleases [53933] (4 families)

5. Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)

6. Protein automated matches [190834] (3 species)
   not a true protein

7. Species Streptomyces aureofaciens [TaxId:1894] [188142] (10 PDB entries)

8. Domain d3d4ac_: 3d4a C: [173674]
   automated match to d1py3b_
   complexed with 3gp, so4

Details for d3d4ac_

PDB Entry: 3d4a, 2.2 Å

PDB Description: Crystal structure of ribonuclease Sa2 with 3'-GMP obtained by ligand diffusion

PDB Compounds: (C:) Ribonuclease

SCOPe Domain Sequences for d3d4ac_:

Sequence, based on SEQRES records:

>d3d4ac_ d.1.1.2 (C:) automated matches {Streptomyces aureofaciens [TaxId: 1894]}
ladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvtpgs
ndrgtrrvvtggygeqywspdhyatfqeidprc

Sequence, based on observed residues (ATOM records):

>d3d4ac_ d.1.1.2 (C:) automated matches {Streptomyces aureofaciens [TaxId: 1894]}
ladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvtprg
trrvvtggygeqywspdhyatfqeidprc

Timeline for d3d4ac_:

• d3d4ac_ first appeared in SCOPe 2.01
  
• d3d4ac_ appears in SCOPe 2.07