Lineage for d3d4aa_ (3d4a A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2530963Fold d.1: Microbial ribonucleases [53932] (1 superfamily)
    single helix packs against antiparallel beta-sheet
  4. 2530964Superfamily d.1.1: Microbial ribonucleases [53933] (4 families) (S)
  5. 2530965Family d.1.1.2: Bacterial ribonucleases [81307] (6 proteins)
  6. 2531160Protein automated matches [190834] (3 species)
    not a true protein
  7. 2531169Species Streptomyces aureofaciens [TaxId:1894] [188142] (10 PDB entries)
  8. 2531191Domain d3d4aa_: 3d4a A: [173672]
    automated match to d1py3b_
    complexed with 3gp, so4

Details for d3d4aa_

PDB Entry: 3d4a (more details), 2.2 Å

PDB Description: Crystal structure of ribonuclease Sa2 with 3'-GMP obtained by ligand diffusion
PDB Compounds: (A:) Ribonuclease

SCOPe Domain Sequences for d3d4aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d4aa_ d.1.1.2 (A:) automated matches {Streptomyces aureofaciens [TaxId: 1894]}
paladvcrtklpsqaqdtlaliakngpypynrdgvvfenresrlpkkgngyyheftvvtp
gsndrgtrrvvtggygeqywspdhyatfqeidprc

SCOPe Domain Coordinates for d3d4aa_:

Click to download the PDB-style file with coordinates for d3d4aa_.
(The format of our PDB-style files is described here.)

Timeline for d3d4aa_: