Lineage for d3d43a_ (3d43 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2873305Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2873306Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2873307Family c.41.1.1: Subtilases [52744] (15 proteins)
  6. 2873644Protein automated matches [190073] (16 species)
    not a true protein
  7. 2873697Species Bacillus sphaericus [TaxId:1421] [188865] (2 PDB entries)
  8. 2873700Domain d3d43a_: 3d43 A: [173669]
    automated match to d1ea7a_
    complexed with ca

Details for d3d43a_

PDB Entry: 3d43 (more details), 0.8 Å

PDB Description: the crystal structure of sph at 0.8a
PDB Compounds: (A:) Sphericase

SCOPe Domain Sequences for d3d43a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d43a_ c.41.1.1 (A:) automated matches {Bacillus sphaericus [TaxId: 1421]}
rasqqipwgikaiynndtltsttggsginiavldtgvntshpdlvnnveqckdftgattp
innsctdrnghgthvagtaladggsdqagiygvapdadlwaykvlldsgsgysddiaaai
rhaadqatatgtktiismslgssannslissavnyayskgvlivaaagnsgysqgtigyp
galpnaiavaalenvqqngtyrvadyssrgyistagdyviqegdieisapgssvystwyn
ggyntisgtsmatphvsglaakiwaenpslsntqlrsnlqeraksvdikggygaaigddy
asgfgfarv

SCOPe Domain Coordinates for d3d43a_:

Click to download the PDB-style file with coordinates for d3d43a_.
(The format of our PDB-style files is described here.)

Timeline for d3d43a_: