SCOPe 2.07: Domain d3d3wb_: 3d3w B:

Lineage for d3d3wb_ (3d3w B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (71 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

6. Protein automated matches [190085] (58 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186828] (33 PDB entries)

8. Domain d3d3wb_: 3d3w B: [173667]
   automated match to d1pr9a_
   complexed with nap, po4

Details for d3d3wb_

PDB Entry: 3d3w, 1.87 Å

PDB Description: Structure of L-Xylulose Reductase with bound coenzyme, phosphate and hydroxide.

PDB Compounds: (B:) L-xylulose reductase

SCOPe Domain Sequences for d3d3wb_:

Sequence; same for both SEQRES and ATOM records:

>d3d3wb_ c.2.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
melflagrrvlvtgagkgigrgtvqalhatgarvvavsrtqadldslvrecpgiepvcvd
lgdweateralgsvgpvdllvnnaavallqpflevtkeafdrsfevnlraviqvsqivar
gliargvpgaivnvssqcsqravtnhsvycstkgaldmltkvmalelgphkirvnavnpt
vvmtsmgqatwsdphkaktmlnriplgkfaevehvvnailfllsdrsgmttgstlpvegg
fwac

Timeline for d3d3wb_:

• d3d3wb_ first appeared in SCOPe 2.01
  
• d3d3wb_ appears in SCOPe 2.06
  
• d3d3wb_ appears in the current release, SCOPe 2.08