| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.79: NusB-like [48012] (1 superfamily) 6 helices: bundle; one central helix is surrounded by 5 others |
Superfamily a.79.1: NusB-like [48013] (4 families) ![]() |
| Family a.79.1.1: Antitermination factor NusB [48014] (2 proteins) automatically mapped to Pfam PF01029 |
| Protein automated matches [190997] (1 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [188726] (3 PDB entries) |
| Domain d3d3cc_: 3d3c C: [173661] automated match to d1ey1a_ protein/RNA complex |
PDB Entry: 3d3c (more details), 2.6 Å
SCOPe Domain Sequences for d3d3cc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d3cc_ a.79.1.1 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
epaarrrarecavqalyswqlsqndiadveyqflaeqdvkdvdvlyfrellagvatntay
ldglmkpylsrlleelgqvekavlrialyelskrsdvpykvaineaielaksfgaedshk
fvngvldkaapvirpnkk
Timeline for d3d3cc_: