![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.79: NusB-like [48012] (1 superfamily) 6 helices: bundle; one central helix is surrounded by 5 others |
![]() | Superfamily a.79.1: NusB-like [48013] (4 families) ![]() |
![]() | Family a.79.1.1: Antitermination factor NusB [48014] (2 proteins) automatically mapped to Pfam PF01029 |
![]() | Protein automated matches [190997] (1 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [188726] (3 PDB entries) |
![]() | Domain d3d3ba_: 3d3b A: [173658] automated match to d1ey1a_ protein/RNA complex; complexed with nhe |
PDB Entry: 3d3b (more details), 1.3 Å
SCOPe Domain Sequences for d3d3ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d3ba_ a.79.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} mepaarrrarecavqalyswqlsqndiadveyqflaeqdvkdvdvlyfrellagvatnta yldglmkpylsrlleelgqvekavlrialyelskrsdvpykvaineaielaksfgaedsh kfvngvldkaapvirpnkk
Timeline for d3d3ba_: