Lineage for d3d36c_ (3d36 C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690637Superfamily a.2.12: Sporulation inhibitor Sda [100985] (1 family) (S)
    automatically mapped to Pfam PF08970
  5. 2690638Family a.2.12.1: Sporulation inhibitor Sda [100986] (2 proteins)
  6. 2690642Protein automated matches [190998] (2 species)
    not a true protein
  7. 2690647Species Geobacillus stearothermophilus [TaxId:272567] [188727] (1 PDB entry)
  8. 2690648Domain d3d36c_: 3d36 C: [173656]
    automated match to d1pv0a_
    complexed with adp, mg, mpd

Details for d3d36c_

PDB Entry: 3d36 (more details), 2.03 Å

PDB Description: How to Switch Off a Histidine Kinase: Crystal Structure of Geobacillus stearothermophilus KinB with the Inhibitor Sda
PDB Compounds: (C:) Sporulation kinase inhibitor Sda

SCOPe Domain Sequences for d3d36c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d36c_ a.2.12.1 (C:) automated matches {Geobacillus stearothermophilus [TaxId: 272567]}
mkhlsdelliesyfkakelnlspefieliekeiqrrslthki

SCOPe Domain Coordinates for d3d36c_:

Click to download the PDB-style file with coordinates for d3d36c_.
(The format of our PDB-style files is described here.)

Timeline for d3d36c_: