SCOPe 2.07: Domain d3d2wa1: 3d2w A:192-261

Lineage for d3d2wa1 (3d2w A:192-261)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein automated matches [190332] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188825] (3 PDB entries)

8. Domain d3d2wa1: 3d2w A:192-261 [173655]
   Other proteins in same PDB: d3d2wa2
   automated match to d1wf0a_
   protein/DNA complex; protein/RNA complex; complexed with po4

Details for d3d2wa1

PDB Entry: 3d2w, 1.65 Å

PDB Description: Crystal structure of mouse TDP-43 RRM2 domain in complex with DNA

PDB Compounds: (A:) TAR DNA-binding protein 43

SCOPe Domain Sequences for d3d2wa1:

Sequence; same for both SEQRES and ATOM records:

>d3d2wa1 d.58.7.1 (A:192-261) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kvfvgrctedmtaeelqqffcqygevvdvfipkpfrafafvtfaddkvaqslcgedliik
gisvhisnae

Timeline for d3d2wa1:

• d3d2wa1 first appeared in SCOPe 2.01, called d3d2wa_
  
• d3d2wa1 appears in SCOPe 2.06
  
• d3d2wa1 appears in the current release, SCOPe 2.08