Lineage for d3d2wa1 (3d2w A:192-261)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195051Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 2195506Protein automated matches [190332] (5 species)
    not a true protein
  7. 2195593Species Mouse (Mus musculus) [TaxId:10090] [188825] (3 PDB entries)
  8. 2195594Domain d3d2wa1: 3d2w A:192-261 [173655]
    Other proteins in same PDB: d3d2wa2
    automated match to d1wf0a_
    protein/DNA complex; protein/RNA complex; complexed with po4

Details for d3d2wa1

PDB Entry: 3d2w (more details), 1.65 Å

PDB Description: Crystal structure of mouse TDP-43 RRM2 domain in complex with DNA
PDB Compounds: (A:) TAR DNA-binding protein 43

SCOPe Domain Sequences for d3d2wa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d2wa1 d.58.7.1 (A:192-261) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kvfvgrctedmtaeelqqffcqygevvdvfipkpfrafafvtfaddkvaqslcgedliik
gisvhisnae

SCOPe Domain Coordinates for d3d2wa1:

Click to download the PDB-style file with coordinates for d3d2wa1.
(The format of our PDB-style files is described here.)

Timeline for d3d2wa1: