Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein automated matches [190332] (5 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188825] (3 PDB entries) |
Domain d3d2wa1: 3d2w A:192-261 [173655] Other proteins in same PDB: d3d2wa2 automated match to d1wf0a_ protein/DNA complex; protein/RNA complex; complexed with po4 |
PDB Entry: 3d2w (more details), 1.65 Å
SCOPe Domain Sequences for d3d2wa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d2wa1 d.58.7.1 (A:192-261) automated matches {Mouse (Mus musculus) [TaxId: 10090]} kvfvgrctedmtaeelqqffcqygevvdvfipkpfrafafvtfaddkvaqslcgedliik gisvhisnae
Timeline for d3d2wa1: