Lineage for d3d2cj_ (3d2c J:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2900958Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
    lack the first two strands of the common fold
  6. 2900979Protein Lipase A [64145] (4 species)
    minimal alpha/beta hydrolase fold;
  7. 2900980Species Bacillus subtilis [TaxId:1423] [64146] (18 PDB entries)
    Uniprot P37957 34-212
  8. 2901022Domain d3d2cj_: 3d2c J: [173646]
    automated match to d1t2na_
    mutant

Details for d3d2cj_

PDB Entry: 3d2c (more details), 2.18 Å

PDB Description: structure of 4d3, a thermostable mutant of bacillus subtilis lipase obtained through directed evolution
PDB Compounds: (J:) Lipase

SCOPe Domain Sequences for d3d2cj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d2cj_ c.69.1.18 (J:) Lipase A {Bacillus subtilis [TaxId: 1423]}
hnpvvmvhgiggsssnfegiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqkv
ldetgakkvdivahsmggantlyyikyldggnkvanvvtlgganrlttdkappgtdpnqk
ilytsiyssddmivmnylsrldgarnvqihgvghmgllyssqvyslikeglngggqntn

SCOPe Domain Coordinates for d3d2cj_:

Click to download the PDB-style file with coordinates for d3d2cj_.
(The format of our PDB-style files is described here.)

Timeline for d3d2cj_: