Lineage for d3d2ci_ (3d2c I:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2507025Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2507026Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2508522Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
    lack the first two strands of the common fold
  6. 2508543Protein Lipase A [64145] (3 species)
    minimal alpha/beta hydrolase fold;
  7. 2508544Species Bacillus subtilis [TaxId:1423] [64146] (18 PDB entries)
    Uniprot P37957 34-212
  8. 2508585Domain d3d2ci_: 3d2c I: [173645]
    automated match to d1t2na_
    mutant

Details for d3d2ci_

PDB Entry: 3d2c (more details), 2.18 Å

PDB Description: structure of 4d3, a thermostable mutant of bacillus subtilis lipase obtained through directed evolution
PDB Compounds: (I:) Lipase

SCOPe Domain Sequences for d3d2ci_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d2ci_ c.69.1.18 (I:) Lipase A {Bacillus subtilis [TaxId: 1423]}
hnpvvmvhgiggsssnfegiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqkv
ldetgakkvdivahsmggantlyyikyldggnkvanvvtlgganrlttdkappgtdpnqk
ilytsiyssddmivmnylsrldgarnvqihgvghmgllyssqvyslikeglngggqntn

SCOPe Domain Coordinates for d3d2ci_:

Click to download the PDB-style file with coordinates for d3d2ci_.
(The format of our PDB-style files is described here.)

Timeline for d3d2ci_: