![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.18: Bacterial lipase [53570] (4 proteins) lack the first two strands of the common fold |
![]() | Protein Lipase A [64145] (4 species) minimal alpha/beta hydrolase fold; |
![]() | Species Bacillus subtilis [TaxId:1423] [64146] (18 PDB entries) Uniprot P37957 34-212 |
![]() | Domain d3d2ca_: 3d2c A: [173637] automated match to d1t2na_ mutant |
PDB Entry: 3d2c (more details), 2.18 Å
SCOPe Domain Sequences for d3d2ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d2ca_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} hnpvvmvhgiggsssnfegiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqkv ldetgakkvdivahsmggantlyyikyldggnkvanvvtlgganrlttdkappgtdpnqk ilytsiyssddmivmnylsrldgarnvqihgvghmgllyssqvyslikeglngggqntn
Timeline for d3d2ca_: