SCOPe 2.08: Domain d3d2bb_: 3d2b B:

Lineage for d3d2bb_ (3d2b B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.18: Bacterial lipase [53570] (4 proteins)
   lack the first two strands of the common fold

6. Protein Lipase A [64145] (4 species)
   minimal alpha/beta hydrolase fold;

7. Species Bacillus subtilis [TaxId:1423] [64146] (18 PDB entries)
   Uniprot P37957 34-212

8. Domain d3d2bb_: 3d2b B: [173636]
   automated match to d1t2na_
   mutant

Details for d3d2bb_

PDB Entry: 3d2b, 1.95 Å

PDB Description: structure of 2d9, a thermostable mutant of bacillus subtilis lipase obtained through directed evolution

PDB Compounds: (B:) Lipase

SCOPe Domain Sequences for d3d2bb_:

Sequence; same for both SEQRES and ATOM records:

>d3d2bb_ c.69.1.18 (B:) Lipase A {Bacillus subtilis [TaxId: 1423]}
hnpvvmvhgiggassnfagiksylvsqgwsrdklyavdfwdktgtnynngpvlsrfvqkv
ldetgakkvdivahsmggantlyyikyldggnkvanvvtlgganrlttgkappgtdpnqk
ilytsiyssddmivmnylsrldgarnvqihgvghmgllyssqvyslikeglngggqntn

Timeline for d3d2bb_:

• d3d2bb_ first appeared in SCOPe 2.01
  
• d3d2bb_ appears in SCOPe 2.07