Lineage for d3d23b_ (3d23 B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 954798Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)
  6. 954843Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (5 species)
    contains an extra alpha-helical domain
  7. 954849Species Human coronavirus [TaxId:443239] [188597] (1 PDB entry)
  8. 954851Domain d3d23b_: 3d23 B: [173628]
    automated match to d1uj1b_
    complexed with 3ih

Details for d3d23b_

PDB Entry: 3d23 (more details), 2.5 Å

PDB Description: main protease of hcov-hku1
PDB Compounds: (B:) 3C-like proteinase

SCOPe Domain Sequences for d3d23b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d23b_ b.47.1.4 (B:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Human coronavirus [TaxId: 443239]}
ssgivkmvsptskiepcivsvtygsmtlnglwlddkvycprhvicsssnmnepdysallc
rvtlgdftimsgrmsltvvsyqmqgcqlvltvslqnpytpkytfgnvkpgetftvlaayn
grpqgafhvtmrssytikgsflcgscgsvgyvltgdsvkfvymhqlelstgchtgtdftg
nfygpyrdaqvvqlpvkdyvqtvnviawlyaailnncawfvqndvcstedfnvwamangf
sqvkadlvldalasmtgvsietllaaikrlymgfqgrqilgsctfedelapsdvyqqlag
v

SCOPe Domain Coordinates for d3d23b_:

Click to download the PDB-style file with coordinates for d3d23b_.
(The format of our PDB-style files is described here.)

Timeline for d3d23b_: