Lineage for d1f4oa_ (1f4o A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1087624Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1087625Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1088597Family a.39.1.8: Penta-EF-hand proteins [63550] (6 proteins)
  6. 1088637Protein Grancalcin [47550] (1 species)
    Calpain small subunit homologue
  7. 1088638Species Human (Homo sapiens) [TaxId:9606] [47551] (4 PDB entries)
  8. 1088644Domain d1f4oa_: 1f4o A: [17362]
    complexed with ca

Details for d1f4oa_

PDB Entry: 1f4o (more details), 2.5 Å

PDB Description: crystal structure of grancalcin with bound calcium
PDB Compounds: (A:) grancalcin

SCOPe Domain Sequences for d1f4oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f4oa_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]}
svytyfsavagqdgevdaeelqrcltqsgingtyspfsletcrimiamldrdhtgkmgfn
afkelwaalnawkenfmtvdqdgsgtvehhelrqaiglmgyrlspqtlttivkryskngr
iffddyvaccvklraltdffkkrdhlqqgsadfiyddflqgtmai

SCOPe Domain Coordinates for d1f4oa_:

Click to download the PDB-style file with coordinates for d1f4oa_.
(The format of our PDB-style files is described here.)

Timeline for d1f4oa_: