Lineage for d3d1ab_ (3d1a B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301856Protein automated matches [190359] (44 species)
    not a true protein
  7. 2302119Species Goat (Capra hircus) [TaxId:9925] [188635] (3 PDB entries)
  8. 2302121Domain d3d1ab_: 3d1a B: [173614]
    automated match to d1fsxb_
    complexed with hem

Details for d3d1ab_

PDB Entry: 3d1a (more details), 2.61 Å

PDB Description: crystal structure determination of goat hemoglobin at 2.61 angstrom resolution
PDB Compounds: (B:) Hemoglobin subunit beta-A

SCOPe Domain Sequences for d3d1ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d1ab_ a.1.1.2 (B:) automated matches {Goat (Capra hircus) [TaxId: 9925]}
mltaeekaavtgfwgkvkvdevgaealgrllvvypwtqrffehfgdlssadavmnnakvk
ahgkkvldsfsngmkhlddlkgtfaqlselhcdklhvdpenfkllgnvlvvvlarhhgse
ftpllqaefqkvvagvanalahryh

SCOPe Domain Coordinates for d3d1ab_:

Click to download the PDB-style file with coordinates for d3d1ab_.
(The format of our PDB-style files is described here.)

Timeline for d3d1ab_: