SCOPe 2.01: Domain d3d10b_: 3d10 B:

Lineage for d3d10b_ (3d10 B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein Calcyclin (S100) [47479] (17 species)

7. Species Human (Homo sapiens), s100b [TaxId:9606] [47483] (6 PDB entries)

8. Domain d3d10b_: 3d10 B: [173609]
   automated match to d1mq1a_
   complexed with ca, pge, zn

Details for d3d10b_

PDB Entry: 3d10, 1.65 Å

PDB Description: Crystal Structure of S100B in the Calcium and Zinc Loaded State at pH 10.0

PDB Compounds: (B:) Protein S100-B

SCOPe Domain Sequences for d3d10b_:

Sequence; same for both SEQRES and ATOM records:

>d3d10b_ a.39.1.2 (B:) Calcyclin (S100) {Human (Homo sapiens), s100b [TaxId: 9606]}
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldndgdgecdfqefmafvamvttacheffeh

Timeline for d3d10b_:

• d3d10b_ is new in SCOPe 2.01-stable
  
• d3d10b_ appears in SCOPe 2.02
  
• d3d10b_ appears in the current release, SCOPe 2.08