Lineage for d3d10b_ (3d10 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2710100Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 2710101Protein Calcyclin (S100) [47479] (17 species)
  7. 2710282Species Human (Homo sapiens), s100b [TaxId:9606] [47483] (11 PDB entries)
  8. 2710287Domain d3d10b_: 3d10 B: [173609]
    automated match to d1mq1a_
    complexed with ca, pge, zn

Details for d3d10b_

PDB Entry: 3d10 (more details), 1.65 Å

PDB Description: Crystal Structure of S100B in the Calcium and Zinc Loaded State at pH 10.0
PDB Compounds: (B:) Protein S100-B

SCOPe Domain Sequences for d3d10b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d10b_ a.39.1.2 (B:) Calcyclin (S100) {Human (Homo sapiens), s100b [TaxId: 9606]}
mselekamvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldndgdgecdfqefmafvamvttacheffeh

SCOPe Domain Coordinates for d3d10b_:

Click to download the PDB-style file with coordinates for d3d10b_.
(The format of our PDB-style files is described here.)

Timeline for d3d10b_: