Lineage for d3d0if_ (3d0i F:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1231741Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
    core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542
  4. 1231742Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) (S)
  5. 1231743Family d.318.1.1: SARS receptor-binding domain-like [143588] (1 protein)
    part of PfamB PB000266
  6. 1231744Protein Spike protein S1 [143589] (1 species)
  7. 1231745Species SARS coronavirus [TaxId:227859] [143590] (6 PDB entries)
    Uniprot P59594 320-502! Uniprot P59594 321-512! Uniprot P59594 323-502
  8. 1231754Domain d3d0if_: 3d0i F: [173603]
    Other proteins in same PDB: d3d0ia_, d3d0ib_
    automated match to d2ajfe1
    complexed with cl, nag, ndg, zn

Details for d3d0if_

PDB Entry: 3d0i (more details), 2.9 Å

PDB Description: crystal structure of spike protein receptor-binding domain from the 2005-2006 sars coronavirus civet strain complexed with human-civet chimeric receptor ace2
PDB Compounds: (F:) Spike protein S1

SCOPe Domain Sequences for d3d0if_:

Sequence, based on SEQRES records: (download)

>d3d0if_ d.318.1.1 (F:) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
pfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcfsnvy
adsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyryl
rhgklrpferdisnvpfspdgkpctppalncywplrgygfyttsgigyqpyrvvvlsfe

Sequence, based on observed residues (ATOM records): (download)

>d3d0if_ d.318.1.1 (F:) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
pfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklnvyadsfvv
kgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyrylrhgklr
pferdisnvpfspdgkpctppalncywplrgygfyttsgigyqpyrvvvlsfe

SCOPe Domain Coordinates for d3d0if_:

Click to download the PDB-style file with coordinates for d3d0if_.
(The format of our PDB-style files is described here.)

Timeline for d3d0if_: