SCOPe 2.01: Domain d3d0if_: 3d0i F:

Lineage for d3d0if_ (3d0i F:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
   core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542

4. Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family)

5. Family d.318.1.1: SARS receptor-binding domain-like [143588] (1 protein)
   part of PfamB PB000266

6. Protein Spike protein S1 [143589] (1 species)

7. Species SARS coronavirus [TaxId:227859] [143590] (6 PDB entries)
   Uniprot P59594 320-502! Uniprot P59594 321-512! Uniprot P59594 323-502

8. Domain d3d0if_: 3d0i F: [173603]
   Other proteins in same PDB: d3d0ia_, d3d0ib_
   automated match to d2ajfe1
   complexed with cl, nag, ndg, zn

Details for d3d0if_

PDB Entry: 3d0i, 2.9 Å

PDB Description: crystal structure of spike protein receptor-binding domain from the 2005-2006 sars coronavirus civet strain complexed with human-civet chimeric receptor ace2

PDB Compounds: (F:) Spike protein S1

SCOPe Domain Sequences for d3d0if_:

Sequence, based on SEQRES records:

>d3d0if_ d.318.1.1 (F:) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
pfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcfsnvy
adsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyryl
rhgklrpferdisnvpfspdgkpctppalncywplrgygfyttsgigyqpyrvvvlsfe

Sequence, based on observed residues (ATOM records):

>d3d0if_ d.318.1.1 (F:) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
pfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklnvyadsfvv
kgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynykyrylrhgklr
pferdisnvpfspdgkpctppalncywplrgygfyttsgigyqpyrvvvlsfe

Timeline for d3d0if_:

• d3d0if_ is new in SCOPe 2.01-stable
  
• d3d0if_ appears in SCOPe 2.02
  
• d3d0if_ appears in the current release, SCOPe 2.08