SCOPe 2.06: Domain d3d0ib_: 3d0i B:

Lineage for d3d0ib_ (3d0i B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.5: Neurolysin-like [55505] (5 proteins)
   combines M2, M3 and M32 families of metalloproteases
   the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain

6. Protein Angiotensin converting enzyme 2, ACE2 [103125] (2 species)

7. Species Paguma larvata [188486] (5 PDB entries)

8. Domain d3d0ib_: 3d0i B: [173601]
   Other proteins in same PDB: d3d0ie_, d3d0if_
   automated match to d1r42a_
   complexed with cl, nag, ndg, zn

Details for d3d0ib_

PDB Entry: 3d0i, 2.9 Å

PDB Description: crystal structure of spike protein receptor-binding domain from the 2005-2006 sars coronavirus civet strain complexed with human-civet chimeric receptor ace2

PDB Compounds: (B:) Angiotensin-converting enzyme 2

SCOPe Domain Sequences for d3d0ib_:

Sequence; same for both SEQRES and ATOM records:

>d3d0ib_ d.92.1.5 (B:) Angiotensin converting enzyme 2, ACE2 {Paguma larvata}
stteelaktfletfnyeaqelsyqssvaswnyntniteenvqnmnnagdkwsaflkeqst
laqmyplqeiqnltvklqlqalqqngssvlsedkskrlntilntmstiystgkvcnpdnp
qeclllepglneimansldynerlwaweswrsevgkqlrplyeeyvvlknemaranhyed
ygdywrgdyevngvdgydysrgqliedvehtfeeikplyehlhayvraklmnaypsyisp
igclpahllgdmwgrfwtnlysltvpfgqkpnidvtdamvdqawdaqrifkeaekffvsv
glpnmtqgfwensmltdpgnvqkavchptawdlgkgdfrilmctkvtmddfltahhemgh
iqydmayaaqpfllrnganegfheavgeimslsaatpkhlksigllspdfqedneteinf
llkqaltivgtlpftymlekwrwmvfkgeipkdqwmkkwwemkreivgvvepvphdetyc
dpaslfhvsndysfiryytrtlyqfqfqealcqaakhegplhkcdisnsteagqklfnml
rlgksepwtlalenvvgaknmnvrpllnyfeplftwlkdqnknsfvgwstdwspyad

Timeline for d3d0ib_:

• d3d0ib_ first appeared in SCOPe 2.01
  
• d3d0ib_ appears in SCOPe 2.05
  
• d3d0ib_ appears in SCOPe 2.07
  
• d3d0ib_ appears in the current release, SCOPe 2.08