![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
![]() | Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) ![]() |
![]() | Family d.92.1.5: Neurolysin-like [55505] (5 proteins) combines M2, M3 and M32 families of metalloproteases the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain |
![]() | Protein Angiotensin converting enzyme 2, ACE2 [103125] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [103126] (34 PDB entries) |
![]() | Domain d3d0ib_: 3d0i B: [173601] Other proteins in same PDB: d3d0ie_, d3d0if_ automated match to d1r42a_ complexed with cl, nag, ndg, zn |
PDB Entry: 3d0i (more details), 2.9 Å
SCOPe Domain Sequences for d3d0ib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3d0ib_ d.92.1.5 (B:) Angiotensin converting enzyme 2, ACE2 {Human (Homo sapiens) [TaxId: 9606]} stteelaktfletfnyeaqelsyqssvaswnyntniteenvqnmnnagdkwsaflkeqst laqmyplqeiqnltvklqlqalqqngssvlsedkskrlntilntmstiystgkvcnpdnp qeclllepglneimansldynerlwaweswrsevgkqlrplyeeyvvlknemaranhyed ygdywrgdyevngvdgydysrgqliedvehtfeeikplyehlhayvraklmnaypsyisp igclpahllgdmwgrfwtnlysltvpfgqkpnidvtdamvdqawdaqrifkeaekffvsv glpnmtqgfwensmltdpgnvqkavchptawdlgkgdfrilmctkvtmddfltahhemgh iqydmayaaqpfllrnganegfheavgeimslsaatpkhlksigllspdfqedneteinf llkqaltivgtlpftymlekwrwmvfkgeipkdqwmkkwwemkreivgvvepvphdetyc dpaslfhvsndysfiryytrtlyqfqfqealcqaakhegplhkcdisnsteagqklfnml rlgksepwtlalenvvgaknmnvrpllnyfeplftwlkdqnknsfvgwstdwspyad
Timeline for d3d0ib_: