Lineage for d3d0ia_ (3d0i A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1034471Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1034472Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1034571Family d.92.1.5: Neurolysin-like [55505] (5 proteins)
    combines M2, M3 and M32 families of metalloproteases
    the N-terminal half of the structure is multihelical; the C-terminal half contains the thermolysin-like catalytic domain
  6. 1034572Protein Angiotensin converting enzyme 2, ACE2 [103125] (2 species)
  7. 1034578Species Paguma larvata [188486] (2 PDB entries)
  8. 1034581Domain d3d0ia_: 3d0i A: [173600]
    Other proteins in same PDB: d3d0ie_, d3d0if_
    automated match to d1r42a_
    complexed with cl, nag, ndg, zn

Details for d3d0ia_

PDB Entry: 3d0i (more details), 2.9 Å

PDB Description: crystal structure of spike protein receptor-binding domain from the 2005-2006 sars coronavirus civet strain complexed with human-civet chimeric receptor ace2
PDB Compounds: (A:) Angiotensin-converting enzyme 2

SCOPe Domain Sequences for d3d0ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d0ia_ d.92.1.5 (A:) Angiotensin converting enzyme 2, ACE2 {Paguma larvata}
stteelaktfletfnyeaqelsyqssvaswnyntniteenvqnmnnagdkwsaflkeqst
laqmyplqeiqnltvklqlqalqqngssvlsedkskrlntilntmstiystgkvcnpdnp
qeclllepglneimansldynerlwaweswrsevgkqlrplyeeyvvlknemaranhyed
ygdywrgdyevngvdgydysrgqliedvehtfeeikplyehlhayvraklmnaypsyisp
igclpahllgdmwgrfwtnlysltvpfgqkpnidvtdamvdqawdaqrifkeaekffvsv
glpnmtqgfwensmltdpgnvqkavchptawdlgkgdfrilmctkvtmddfltahhemgh
iqydmayaaqpfllrnganegfheavgeimslsaatpkhlksigllspdfqedneteinf
llkqaltivgtlpftymlekwrwmvfkgeipkdqwmkkwwemkreivgvvepvphdetyc
dpaslfhvsndysfiryytrtlyqfqfqealcqaakhegplhkcdisnsteagqklfnml
rlgksepwtlalenvvgaknmnvrpllnyfeplftwlkdqnknsfvgwstdwspyad

SCOPe Domain Coordinates for d3d0ia_:

Click to download the PDB-style file with coordinates for d3d0ia_.
(The format of our PDB-style files is described here.)

Timeline for d3d0ia_: