Lineage for d3d0cb_ (3d0c B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836523Species Oceanobacillus iheyensis [TaxId:221109] [188435] (1 PDB entry)
  8. 2836525Domain d3d0cb_: 3d0c B: [173599]
    Other proteins in same PDB: d3d0ca2
    automated match to d1xkya1

Details for d3d0cb_

PDB Entry: 3d0c (more details), 1.9 Å

PDB Description: crystal structure of dihydrodipicolinate synthase from oceanobacillus iheyensis at 1.9 a resolution
PDB Compounds: (B:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3d0cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d0cb_ c.1.10.0 (B:) automated matches {Oceanobacillus iheyensis [TaxId: 221109]}
dygefskrfstisginivpflegtreidwkglddnvefllqngievivpngntgefyalt
ieeakqvatrvtelvngratvvagigysvdtaielgksaidsgadcvmihqpvhpyitda
gaveyyrniiealdapsiiyfkdahlsddvikelapldklvgikyaindiqrvtqvmrav
pkssnvaficgtaekwapffyhagavgftsglvnvfpqksfallealeegnqekiwdvwe
dvvpfedlrakhnngnnvviikeameqlglragvtrepvnplspndrleleellkswntq

SCOPe Domain Coordinates for d3d0cb_:

Click to download the PDB-style file with coordinates for d3d0cb_.
(The format of our PDB-style files is described here.)

Timeline for d3d0cb_: