SCOPe 2.05: Domain d3d0ca_: 3d0c A:

Lineage for d3d0ca_ (3d0c A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.0: automated matches [191319] (1 protein)
   not a true family

6. Protein automated matches [190115] (63 species)
   not a true protein

7. Species Oceanobacillus iheyensis [TaxId:221109] [188435] (1 PDB entry)

8. Domain d3d0ca_: 3d0c A: [173598]
   automated match to d1xkya1

Details for d3d0ca_

PDB Entry: 3d0c, 1.9 Å

PDB Description: crystal structure of dihydrodipicolinate synthase from oceanobacillus iheyensis at 1.9 a resolution

PDB Compounds: (A:) Dihydrodipicolinate synthase

SCOPe Domain Sequences for d3d0ca_:

Sequence; same for both SEQRES and ATOM records:

>d3d0ca_ c.1.10.0 (A:) automated matches {Oceanobacillus iheyensis [TaxId: 221109]}
ldygefskrfstisginivpflegtreidwkglddnvefllqngievivpngntgefyal
tieeakqvatrvtelvngratvvagigysvdtaielgksaidsgadcvmihqpvhpyitd
agaveyyrniiealdapsiiyfkdahlsddvikelapldklvgikyaindiqrvtqvmra
vpkssnvaficgtaekwapffyhagavgftsglvnvfpqksfallealeegnqekiwdvw
edvvpfedlrakhnngnnvviikeameqlglragvtrepvnplspndrleleellkswnt
qe

Timeline for d3d0ca_:

• d3d0ca_ first appeared in SCOPe 2.01
  
• d3d0ca_ appears in SCOPe 2.04
  
• d3d0ca_ is called d3d0ca1 in SCOPe 2.06
  
• d3d0ca_ appears in the current release, SCOPe 2.08, called d3d0ca1