Lineage for d3d09a_ (3d09 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1771693Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1772172Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 1772173Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 1772174Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 1772175Species Human (Homo sapiens) [TaxId:9606] [49420] (34 PDB entries)
  8. 1772208Domain d3d09a_: 3d09 A: [173593]
    automated match to d1gzha_
    complexed with zn; mutant

Details for d3d09a_

PDB Entry: 3d09 (more details), 1.9 Å

PDB Description: human p53 core domain with hot spot mutation r249s and second-site suppressor mutations h168r and t123a
PDB Compounds: (A:) Cellular tumor antigen p53

SCOPe Domain Sequences for d3d09a_:

Sequence, based on SEQRES records: (download)

>d3d09a_ b.2.5.2 (A:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvactyspalnkmfcqlaktcpvqlwvdstpppgt
rvramaiykqsqrmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
vvvpyeppevgsdcttihynymcnsscmggmnrspiltiitledssgnllgrnsfevrvc
acpgrdrrteeenlr

Sequence, based on observed residues (ATOM records): (download)

>d3d09a_ b.2.5.2 (A:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsvactyspalnkmfcqlaktcpvqlwvdstpppgtrvram
aiykqsqrmtevvrrcphhercsdglappqhlirvegnlrveylddrntfrhsvvvpyep
pevgsdcttihynymcnsscmggmnrspiltiitledssgnllgrnsfevrvcacpgrdr
rteeenlr

SCOPe Domain Coordinates for d3d09a_:

Click to download the PDB-style file with coordinates for d3d09a_.
(The format of our PDB-style files is described here.)

Timeline for d3d09a_: