Lineage for d3d07b_ (3d07 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2033752Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2034243Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2034244Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 protein domains)
  6. 2034245Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 2034246Species Human (Homo sapiens) [TaxId:9606] [49420] (40 PDB entries)
  8. 2034296Domain d3d07b_: 3d07 B: [173591]
    automated match to d1gzha_
    complexed with zn; mutant

Details for d3d07b_

PDB Entry: 3d07 (more details), 2.2 Å

PDB Description: Human p53 core domain with hot spot mutation R249S (III)
PDB Compounds: (B:) Cellular tumor antigen p53

SCOPe Domain Sequences for d3d07b_:

Sequence, based on SEQRES records: (download)

>d3d07b_ b.2.5.2 (B:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppg
trvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrh
svvvpyeppevgsdcttihynymcnsscmggmnrspiltiitledssgnllgrnsfevrv
cacpgrdrrteeenlrkk

Sequence, based on observed residues (ATOM records): (download)

>d3d07b_ b.2.5.2 (B:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
ssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppg
trvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrh
svvvpyeppevgsdcttihynymcnsscmggmnspiltiitledssgnllgrnsfevrvc
acpgrdrrteeenlrkk

SCOPe Domain Coordinates for d3d07b_:

Click to download the PDB-style file with coordinates for d3d07b_.
(The format of our PDB-style files is described here.)

Timeline for d3d07b_: