Lineage for d3d04c_ (3d04 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944056Family d.38.1.6: FabZ-like [110902] (1 protein)
    automatically mapped to Pfam PF07977
  6. 2944057Protein (3R)-hydroxymyristoyl ACP dehydrase FabZ [110903] (3 species)
  7. 2944058Species Helicobacter pylori [TaxId:210] [188573] (17 PDB entries)
  8. 2944079Domain d3d04c_: 3d04 C: [173584]
    automated match to d1u1za_
    complexed with ben, cl, sak

Details for d3d04c_

PDB Entry: 3d04 (more details), 2.4 Å

PDB Description: Crystal structure of (3R)-Hydroxyacyl-Acyl Carrier Protein Dehydratase (FabZ) from Helicobacter pylori in complex with sakuranetin
PDB Compounds: (C:) (3R)-hydroxymyristoyl-acyl carrier protein dehydratase

SCOPe Domain Sequences for d3d04c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3d04c_ d.38.1.6 (C:) (3R)-hydroxymyristoyl ACP dehydrase FabZ {Helicobacter pylori [TaxId: 210]}
qsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpgv
livegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlkh
kgmiwqvggtaqvdgkvvaeaelkamiaer

SCOPe Domain Coordinates for d3d04c_:

Click to download the PDB-style file with coordinates for d3d04c_.
(The format of our PDB-style files is described here.)

Timeline for d3d04c_: