SCOPe 2.01: Domain d3cz4a_: 3cz4 A:

Lineage for d3cz4a_ (3cz4 A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
   the insertion subdomain is a helical hairpin

6. Protein Class B acid phosphatase, AphA [102308] (2 species)

7. Species Escherichia coli [TaxId:562] [102309] (11 PDB entries)
   Uniprot P32697 27-237

8. Domain d3cz4a_: 3cz4 A: [173560]
   automated match to d1rmta_
   complexed with act, cl, edo, mg

Details for d3cz4a_

PDB Entry: 3cz4, 1.7 Å

PDB Description: Native AphA class B acid phosphatase/phosphotransferase from E. coli

PDB Compounds: (A:) Class B acid phosphatase

SCOPe Domain Sequences for d3cz4a_:

Sequence; same for both SEQRES and ATOM records:

>d3cz4a_ c.108.1.12 (A:) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]}
splnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkktf
spesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktetvs
ktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgargi
rilrasnstykplpqagafgeevivnsey

Timeline for d3cz4a_:

• d3cz4a_ is new in SCOPe 2.01-stable
  
• d3cz4a_ appears in SCOPe 2.02
  
• d3cz4a_ appears in the current release, SCOPe 2.08