Lineage for d1djya1 (1djy A:200-298)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 768455Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 768456Superfamily a.39.1: EF-hand [47473] (11 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 769152Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (8 proteins)
  6. 769190Protein Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) [47548] (1 species)
  7. 769191Species Rat (Rattus norvegicus) [TaxId:10116] [47549] (10 PDB entries)
  8. 769206Domain d1djya1: 1djy A:200-298 [17356]
    Other proteins in same PDB: d1djya2, d1djya3, d1djyb2, d1djyb3

Details for d1djya1

PDB Entry: 1djy (more details), 2.8 Å

PDB Description: phosphoinositide-specific phospholipase c-delta1 from rat complexed with inositol-2,4,5-trisphosphate
PDB Compounds: (A:) phosphoinositide-specific phospholipase c, isozyme delta1

SCOP Domain Sequences for d1djya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1djya1 a.39.1.7 (A:200-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]}
eietfykmltqraeidrafeeaagsaetlsverlvtflqhqqreeeagpalalslierye
psetakaqrqmtkdgflmyllsadgnafslahrrvyqdm

SCOP Domain Coordinates for d1djya1:

Click to download the PDB-style file with coordinates for d1djya1.
(The format of our PDB-style files is described here.)

Timeline for d1djya1: