SCOPe 2.08: Domain d3cz2a_: 3cz2 A:

Lineage for d3cz2a_ (3cz2 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
   automatically mapped to Pfam PF01395

6. Protein Pheromone-binding protein asp1 [101192] (1 species)

7. Species Honeybee (Apis mellifera) [TaxId:7460] [101193] (15 PDB entries)

8. Domain d3cz2a_: 3cz2 A: [173558]
   automated match to d1r5ra_
   complexed with cl

Details for d3cz2a_

PDB Entry: 3cz2, 2.5 Å

PDB Description: Dimeric crystal structure of a pheromone binding protein from Apis mellifera at pH 7.0

PDB Compounds: (A:) Pheromone-binding protein ASP1

SCOPe Domain Sequences for d3cz2a_:

Sequence; same for both SEQRES and ATOM records:

>d3cz2a_ a.39.2.1 (A:) Pheromone-binding protein asp1 {Honeybee (Apis mellifera) [TaxId: 7460]}
pdwvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvdd
eanvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi

Timeline for d3cz2a_:

• d3cz2a_ first appeared in SCOPe 2.01
  
• d3cz2a_ appears in SCOPe 2.07