Lineage for d3cz1b_ (3cz1 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2711837Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families) (S)
    the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity
  5. 2711838Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
    automatically mapped to Pfam PF01395
  6. 2711884Protein Pheromone-binding protein asp1 [101192] (1 species)
  7. 2711885Species Honeybee (Apis mellifera) [TaxId:7460] [101193] (15 PDB entries)
  8. 2711887Domain d3cz1b_: 3cz1 B: [173557]
    automated match to d1r5ra_
    complexed with cl, gol, mg, nbb

Details for d3cz1b_

PDB Entry: 3cz1 (more details), 1.5 Å

PDB Description: Dimeric crystal structure of a pheromone binding protein from Apis mellifera in complex with the n-butyl benzene sulfonamide at pH 7.0
PDB Compounds: (B:) Pheromone-binding protein ASP1

SCOPe Domain Sequences for d3cz1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cz1b_ a.39.2.1 (B:) Pheromone-binding protein asp1 {Honeybee (Apis mellifera) [TaxId: 7460]}
vppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvddean
vdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi

SCOPe Domain Coordinates for d3cz1b_:

Click to download the PDB-style file with coordinates for d3cz1b_.
(The format of our PDB-style files is described here.)

Timeline for d3cz1b_: