Lineage for d1qatb1 (1qat B:206-298)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3180Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 3181Superfamily a.39.1: EF-hand [47473] (7 families) (S)
  5. 3451Family a.39.1.7: EF-hand modules in multidomain proteins [47547] (7 proteins)
  6. 3493Protein Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) [47548] (1 species)
  7. 3494Species Rat (Rattus norvegicus) [TaxId:10116] [47549] (10 PDB entries)
  8. 3510Domain d1qatb1: 1qat B:206-298 [17355]
    Other proteins in same PDB: d1qata2, d1qata3, d1qatb2, d1qatb3

Details for d1qatb1

PDB Entry: 1qat (more details), 3 Å

PDB Description: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase delta complex with samarium (iii) chloride

SCOP Domain Sequences for d1qatb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qatb1 a.39.1.7 (B:206-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus)}
kmltqraeidrafeeaagsaetlsverlvtflqhqqreeeagpalalslieryepsetak
aqrqmtkdgflmyllsadgnafslahrrvyqdm

SCOP Domain Coordinates for d1qatb1:

Click to download the PDB-style file with coordinates for d1qatb1.
(The format of our PDB-style files is described here.)

Timeline for d1qatb1: