Lineage for d3cyva_ (3cyv A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089841Superfamily c.1.22: UROD/MetE-like [51726] (3 families) (S)
  5. 2089842Family c.1.22.1: Uroporphyrinogen decarboxylase, UROD [51727] (2 protein domains)
    automatically mapped to Pfam PF01208
  6. 2089843Protein Uroporphyrinogen decarboxylase, UROD [51728] (3 species)
  7. 2089864Species Shigella flexneri [TaxId:623] [188863] (1 PDB entry)
  8. 2089865Domain d3cyva_: 3cyv A: [173547]
    automated match to d1r3qa_

Details for d3cyva_

PDB Entry: 3cyv (more details), 2.8 Å

PDB Description: Crystal structure of uroporphyrinogen decarboxylase from Shigella flexineri: new insights into its catalytic mechanism
PDB Compounds: (A:) Uroporphyrinogen decarboxylase

SCOPe Domain Sequences for d3cyva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cyva_ c.1.22.1 (A:) Uroporphyrinogen decarboxylase, UROD {Shigella flexneri [TaxId: 623]}
elkndrylrallrqpvdvtpvwmmrqagrylpeykatraqagdfmslcknaelacevtlq
plrrypldaailfsdiltvpdamglglyfeagegprftspvtckadvdklpipdpedelg
yvmnavrtirhelkgevpligfsgspwtlatymveggsskaftvikkmmyadpqalhall
dklaksvtlylnaqikagaqavmifdtwggvltgrdyqqfslyymhkivdgllrendgrr
vpvtlftkgggqwleamaetgcdalgldwttdiadarrrvgnkvalqgnmdpsmlyappa
rieeevatilagfghgeghvfnlghgihqdvppehagvfveavhrlseqyhr

SCOPe Domain Coordinates for d3cyva_:

Click to download the PDB-style file with coordinates for d3cyva_.
(The format of our PDB-style files is described here.)

Timeline for d3cyva_: