Lineage for d3cyla_ (3cyl A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2345955Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2345956Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2345961Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2346077Protein Snake phospholipase A2 [48624] (38 species)
  7. 2346120Species Bothrops pirajai, Piratoxin-II (PRTX-II) [TaxId:113192] [48633] (3 PDB entries)
  8. 2346123Domain d3cyla_: 3cyl A: [173545]
    automated match to d1qlla_
    complexed with pe4, so4, vit

Details for d3cyla_

PDB Entry: 3cyl (more details), 1.87 Å

PDB Description: Crystal structure of Piratoxin I (a myotoxic Lys49-PLA2) complexed with alpha-tocopherol
PDB Compounds: (A:) Phospholipase A2 homolog 2

SCOPe Domain Sequences for d3cyla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cyla_ a.133.1.2 (A:) Snake phospholipase A2 {Bothrops pirajai, Piratoxin-II (PRTX-II) [TaxId: 113192]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadd
c

SCOPe Domain Coordinates for d3cyla_:

Click to download the PDB-style file with coordinates for d3cyla_.
(The format of our PDB-style files is described here.)

Timeline for d3cyla_: