SCOPe 2.06: Domain d3cyla_: 3cyl A:

Lineage for d3cyla_ (3cyl A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein Snake phospholipase A2 [48624] (38 species)

7. Species Bothrops pirajai, Piratoxin-II (PRTX-II) [TaxId:113192] [48633] (3 PDB entries)

8. Domain d3cyla_: 3cyl A: [173545]
   automated match to d1qlla_
   complexed with pe4, so4, vit

Details for d3cyla_

PDB Entry: 3cyl, 1.87 Å

PDB Description: Crystal structure of Piratoxin I (a myotoxic Lys49-PLA2) complexed with alpha-tocopherol

PDB Compounds: (A:) Phospholipase A2 homolog 2

SCOPe Domain Sequences for d3cyla_:

Sequence; same for both SEQRES and ATOM records:

>d3cyla_ a.133.1.2 (A:) Snake phospholipase A2 {Bothrops pirajai, Piratoxin-II (PRTX-II) [TaxId: 113192]}
slfelgkmilqetgknpaksygaygcncgvlgrgkpkdatdrccyvhkccykkltgcnpk
kdrysyswkdktivcgennpclkelcecdkavaiclrenlgtynkkyryhlkpfckkadd
c

Timeline for d3cyla_:

• d3cyla_ first appeared in SCOPe 2.01
  
• d3cyla_ appears in SCOPe 2.05
  
• d3cyla_ appears in SCOPe 2.07
  
• d3cyla_ appears in the current release, SCOPe 2.08