Lineage for d3cyia1 (3cyi A:32-137)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009272Fold d.268: ParB/Sulfiredoxin [110848] (1 superfamily)
    beta*-alpha-beta(2)-alpha-beta-alpha; mixed beta sheet forms a partly open barrel: (n*=4, S*=8)
  4. 3009273Superfamily d.268.1: ParB/Sulfiredoxin [110849] (5 families) (S)
  5. 3009308Family d.268.1.4: Sulfiredoxin-like [160095] (2 proteins)
    PfamB PB015736
  6. 3009309Protein Sulfiredoxin [160096] (1 species)
  7. 3009310Species Human (Homo sapiens) [TaxId:9606] [160097] (6 PDB entries)
    Uniprot Q9BYN0 17-137! Uniprot Q9BYN0 28-137! Uniprot Q9BYN0 30-137
  8. 3009312Domain d3cyia1: 3cyi A:32-137 [173544]
    Other proteins in same PDB: d3cyia2
    automated match to d1xw3a1
    complexed with atp, mg

Details for d3cyia1

PDB Entry: 3cyi (more details), 1.8 Å

PDB Description: crystal structure of human sulfiredoxin (srx) in complex with atp:mg2+
PDB Compounds: (A:) Sulfiredoxin-1

SCOPe Domain Sequences for d3cyia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cyia1 d.268.1.4 (A:32-137) Sulfiredoxin {Human (Homo sapiens) [TaxId: 9606]}
sihsgriaavhnvplsvlirplpsvldpakvqslvdtiredpdsvppidvlwikgaqggd
yfysfggshryaayqqlqretipaklvqstlsdlrvylgastpdlq

SCOPe Domain Coordinates for d3cyia1:

Click to download the PDB-style file with coordinates for d3cyia1.
(The format of our PDB-style files is described here.)

Timeline for d3cyia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cyia2