SCOPe 2.03: Domain d3cy5d_: 3cy5 D:

Lineage for d3cy5d_ (3cy5 D:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (36 species)
   not a true protein

7. Species Buffalo (Bubalus bubalis) [TaxId:89462] [188864] (1 PDB entry)

8. Domain d3cy5d_: 3cy5 D: [173539]
   automated match to d1fsxb_
   complexed with hem

Details for d3cy5d_

PDB Entry: 3cy5, 2 Å

PDB Description: crystal structure determination of buffalo (bubalus bubalis) hemoglobin at 2 angstrom resolution

PDB Compounds: (D:) Hemoglobin subunit beta

SCOPe Domain Sequences for d3cy5d_:

Sequence; same for both SEQRES and ATOM records:

>d3cy5d_ a.1.1.2 (D:) automated matches {Buffalo (Bubalus bubalis) [TaxId: 89462]}
mltaeekaavtafwgkvhvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarhfgke
ftpvlqadfqkvvagvanalahryh

Timeline for d3cy5d_:

• d3cy5d_ first appeared in SCOPe 2.01
  
• d3cy5d_ appears in SCOPe 2.02
  
• d3cy5d_ appears in SCOPe 2.04
  
• d3cy5d_ appears in the current release, SCOPe 2.08