Lineage for d3cy5c_ (3cy5 C:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1475069Protein automated matches [190359] (38 species)
    not a true protein
  7. 1475160Species Buffalo (Bubalus bubalis) [TaxId:89462] [188864] (1 PDB entry)
  8. 1475163Domain d3cy5c_: 3cy5 C: [173538]
    automated match to d1fsxa_
    complexed with hem

Details for d3cy5c_

PDB Entry: 3cy5 (more details), 2 Å

PDB Description: crystal structure determination of buffalo (bubalus bubalis) hemoglobin at 2 angstrom resolution
PDB Compounds: (C:) Hemoglobin subunit alpha-2

SCOPe Domain Sequences for d3cy5c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cy5c_ a.1.1.2 (C:) automated matches {Buffalo (Bubalus bubalis) [TaxId: 89462]}
vlsaadksniqaawgkvgghaadygaealermflsfpttktyfphfdlshgsaqvkghga
kvanaltkavghlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpndftpa
vhasldkflasvstvltskyr

SCOPe Domain Coordinates for d3cy5c_:

Click to download the PDB-style file with coordinates for d3cy5c_.
(The format of our PDB-style files is described here.)

Timeline for d3cy5c_: