Lineage for d3cy5b_ (3cy5 B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 903555Protein automated matches [190359] (30 species)
    not a true protein
  7. 903638Species Buffalo (Bubalus bubalis) [TaxId:89462] [188864] (1 PDB entry)
  8. 903640Domain d3cy5b_: 3cy5 B: [173537]
    automated match to d1fsxb_
    complexed with hem

Details for d3cy5b_

PDB Entry: 3cy5 (more details), 2 Å

PDB Description: crystal structure determination of buffalo (bubalus bubalis) hemoglobin at 2 angstrom resolution
PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d3cy5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cy5b_ a.1.1.2 (B:) automated matches {Buffalo (Bubalus bubalis) [TaxId: 89462]}
mltaeekaavtafwgkvhvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarhfgke
ftpvlqadfqkvvagvanalahryh

SCOPe Domain Coordinates for d3cy5b_:

Click to download the PDB-style file with coordinates for d3cy5b_.
(The format of our PDB-style files is described here.)

Timeline for d3cy5b_: