| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein automated matches [190359] (43 species) not a true protein |
| Species Buffalo (Bubalus bubalis) [TaxId:89462] [188864] (1 PDB entry) |
| Domain d3cy5b_: 3cy5 B: [173537] automated match to d1fsxb_ complexed with hem |
PDB Entry: 3cy5 (more details), 2 Å
SCOPe Domain Sequences for d3cy5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cy5b_ a.1.1.2 (B:) automated matches {Buffalo (Bubalus bubalis) [TaxId: 89462]}
mltaeekaavtafwgkvhvdevggealgrllvvypwtqrffesfgdlstadavmnnpkvk
ahgkkvldsfsngmkhlddlkgtfaalselhcdklhvdpenfkllgnvlvvvlarhfgke
ftpvlqadfqkvvagvanalahryh
Timeline for d3cy5b_: