Class a: All alpha proteins [46456] (285 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein automated matches [190359] (38 species) not a true protein |
Species Buffalo (Bubalus bubalis) [TaxId:89462] [188864] (1 PDB entry) |
Domain d3cy5a_: 3cy5 A: [173536] automated match to d1fsxa_ complexed with hem |
PDB Entry: 3cy5 (more details), 2 Å
SCOPe Domain Sequences for d3cy5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cy5a_ a.1.1.2 (A:) automated matches {Buffalo (Bubalus bubalis) [TaxId: 89462]} vlsaadksniqaawgkvgghaadygaealermflsfpttktyfphfdlshgsaqvkghga kvanaltkavghlddlpgalselsdlhahklrvdpvnfkllshsllvtlashlpndftpa vhasldkflasvstvltskyr
Timeline for d3cy5a_: