Lineage for d3cxva_ (3cxv A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2004955Protein Cyp121 monooxygenase (P450 Mt2) [81865] (2 species)
  7. 2004956Species Mycobacterium tuberculosis [TaxId:1773] [81866] (35 PDB entries)
  8. 2004978Domain d3cxva_: 3cxv A: [173530]
    automated match to d1n40a_
    complexed with hem, so4; mutant

Details for d3cxva_

PDB Entry: 3cxv (more details), 1.7 Å

PDB Description: Crystal structure of the Cytochrome P450 CYP121 A233G mutant from Mycobacterium tuberculosis
PDB Compounds: (A:) Cytochrome P450 121

SCOPe Domain Sequences for d3cxva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cxva_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]}
tatvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrfs
mketaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtansll
dnlitegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaakin
wdrdieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgggvistgsf
lttalisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvrk
gelvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigiea
llkkmpgvdlavpidqlvwrtrfqrriperlpvlw

SCOPe Domain Coordinates for d3cxva_:

Click to download the PDB-style file with coordinates for d3cxva_.
(The format of our PDB-style files is described here.)

Timeline for d3cxva_: