Lineage for d3cx7b_ (3cx7 B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1275178Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 1275179Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 1275180Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)
  6. 1275227Protein automated matches [190756] (2 species)
    not a true protein
  7. 1275233Species Norway rat (Rattus norvegicus) [TaxId:10116] [188643] (3 PDB entries)
  8. 1275235Domain d3cx7b_: 3cx7 B: [173525]
    automated match to d1htjf_
    complexed with alf, gdp, mg

Details for d3cx7b_

PDB Entry: 3cx7 (more details), 2.25 Å

PDB Description: Crystal Structure of PDZRhoGEF rgRGS Domain in a Complex with Galpha-13 Bound to GDP-AlF4
PDB Compounds: (B:) Glutamate Transporter Associated Protein 48

SCOPe Domain Sequences for d3cx7b_:

Sequence, based on SEQRES records: (download)

>d3cx7b_ a.91.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
liigpeedydpgyfnnesdiifqdleklkshpaylvvflryilsqadpgpllfylcsevy
qqtnpkdsrslgkdiwnifleknaplrvkipemlqaeidlrlrnnedprnvlceaqeavm
leiqeqindyrskrtlglgslygendllgldgdplrerqmaekqlaalgdilskyeedrs
apmdfavntfmshagi

Sequence, based on observed residues (ATOM records): (download)

>d3cx7b_ a.91.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
liigpeedydpgnesdiifqdleklkshpaylvvflryilsqadpgpllfylcsevyqqt
npkdsrslgkdiwnifleknaplrvkipemlqaeidlrlrnnedprnvlceaqeavmlei
qeqindyrskrtlglgslygendllgldgdplrerqmaekqlaalgdilskyeedrsapm
dfavntfmshagi

SCOPe Domain Coordinates for d3cx7b_:

Click to download the PDB-style file with coordinates for d3cx7b_.
(The format of our PDB-style files is described here.)

Timeline for d3cx7b_: