SCOPe 2.01: Domain d3cx2a_: 3cx2 A:

Lineage for d3cx2a_ (3cx2 A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Cardiac myosin binding protein C, different domains [89185] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89186] (4 PDB entries)
   Uniprot Q14896 358-451, 641-770

8. Domain d3cx2a_: 3cx2 A: [173520]
   automated match to d2avga1

Details for d3cx2a_

PDB Entry: 3cx2, 1.3 Å

PDB Description: crystal structure of the c1 domain of cardiac isoform of myosin binding protein-c at 1.3a

PDB Compounds: (A:) Myosin-binding protein C, cardiac-type

SCOPe Domain Sequences for d3cx2a_:

Sequence, based on SEQRES records:

>d3cx2a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]}
ddpiglfvmrpqdgevtvggsitfsarvagasllkppvvkwfkgkwvdlsskvgqhlqlh
dsydraskvylfelhitdaqpaftgsyrcevstkdkfdcsnfnltvhe

Sequence, based on observed residues (ATOM records):

>d3cx2a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]}
ddpiglfvmrpqdgevtvggsitfsarvagallkppvvkwfkgkwvdlsskvgqhlqlhd
sydraskvylfelhitdaqpaftgsyrcevstkdkfdcsnfnltvhe

Timeline for d3cx2a_:

• d3cx2a_ is new in SCOPe 2.01-stable
  
• d3cx2a_ appears in SCOPe 2.02
  
• d3cx2a_ appears in the current release, SCOPe 2.08