Lineage for d3cx2a_ (3cx2 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753567Protein Cardiac myosin binding protein C, different domains [89185] (1 species)
  7. 2753568Species Human (Homo sapiens) [TaxId:9606] [89186] (5 PDB entries)
    Uniprot Q14896 358-451, 641-770
  8. 2753569Domain d3cx2a_: 3cx2 A: [173520]
    automated match to d2avga1

Details for d3cx2a_

PDB Entry: 3cx2 (more details), 1.3 Å

PDB Description: crystal structure of the c1 domain of cardiac isoform of myosin binding protein-c at 1.3a
PDB Compounds: (A:) Myosin-binding protein C, cardiac-type

SCOPe Domain Sequences for d3cx2a_:

Sequence, based on SEQRES records: (download)

>d3cx2a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]}
ddpiglfvmrpqdgevtvggsitfsarvagasllkppvvkwfkgkwvdlsskvgqhlqlh
dsydraskvylfelhitdaqpaftgsyrcevstkdkfdcsnfnltvhe

Sequence, based on observed residues (ATOM records): (download)

>d3cx2a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]}
ddpiglfvmrpqdgevtvggsitfsarvagallkppvvkwfkgkwvdlsskvgqhlqlhd
sydraskvylfelhitdaqpaftgsyrcevstkdkfdcsnfnltvhe

SCOPe Domain Coordinates for d3cx2a_:

Click to download the PDB-style file with coordinates for d3cx2a_.
(The format of our PDB-style files is described here.)

Timeline for d3cx2a_: